Serpin A4/Kallistatin Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Serpin A4/Kallistatin Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Serpin A4/Kallistatin
  
  

  Source: E.coli

  Amino Acid Sequence: HGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASET

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SERPINA4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25131It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Serpin A4/Kallistatin Recombinant Protein Antigen

• antitrypsin), member 4
• KAL
• Kallistatin
• KLST
• KSTKallikrein inhibitor
• member 4
• PI-4
• PI4Peptidase inhibitor 4
• protease inhibitor 4 (kallistatin)
• serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase
• Serpin A4
• serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin)

Background

Kallistatin inhibits human amidolytic and kininogenase activities of tissue kallikrein. Inhibition is achieved by formation of an equimolar, heat- and SDS-stable complex between the inhibitor and the enzyme, and generation of a small C-terminal fragment of the inhibi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SERPINA4