SERP1 Antibody - BSA Free

Western Blot: SERP1 Antibody [NBP1-98592] - Titration: 1.0 ug/ml Positive Control: MCF7 Whole Cell.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SERP1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is SERP1 - N-terminal region. Peptide sequence IRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIF. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SERP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 7 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30497776).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SERP1 Antibody - BSA Free

• FLJ43424
• MGC117327
• MGC133321
• RAMP4MGC133322
• ribosome associated membrane protein 4
• Ribosome-attached membrane protein 4
• stress-associated endoplasmic reticulum protein 1

Background

SERP1 interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. SERP1 protects unfolded target proteins against degradation during ER stress. SERP1 may facilitate glycosylation of target proteins after termination of ER stress. SERP1 may modulate the use of N-glycosylation sites on target proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SERP1 Antibody (NBP1-98592)(1)

Publication using NBP1-98592

• Shang L, Dong P, Du L et al. SERP1 prevents hypoxia-reoxygenation-induced H9c2 apoptosis through activating JAK2/STAT3 pathway-dependent attenuation of endoplasmic reticulum stress. bioRxiv. 2018-11-14 [PMID: 30497776] (WB, Mouse)

Bioinformatics

• Gene Symbol: SERP1
• Uniprot:
  • NP_055260(Human)