Recombinant Human Serotonin N-acetyltransferase Protein

Images

 
SDS-Page: Recombinant Human Serotonin N-acetyltransferase Protein [H00000015-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Serotonin N-acetyltransferase Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-79 of Human AANAT partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVLGVCPLYLDEIRHFLTLCPE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
AANAT
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Serotonin N-acetyltransferase Protein

  • AA-NAT
  • aralkylamine N-acetyltransferaseEC 2.3.1.87
  • arylalkylamine N-acetyltransferase
  • Serotonin acetylase
  • SNATserotonin N-acetyltransferase

Background

Arylalkylamine N-acetyltransferase belongs to the superfamily of acetyltransferases. It is the penultimate enzyme in melatonin synthesis and controls the night/day rhythm in melatonin production in the vertebrate pineal gland. Melatonin is essential for seasonal reproduction, modulates the function of the circadian clock in the suprachiasmatic nucleus, and influences activity and sleep. This enzyme is rapidly inactivated when animals are exposed to light at night. This protein is 80% identical to sheep and rat AA-NAT. Arylalkylamine N-acetyltransferase may contribute a multifactorial genetic diseases such as altered behavior in sleep/wake cycle. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43801
Species: Hu
Applications: WB
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81760
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-28912
Species: Hu
Applications: WB, PEP-ELISA
NB100-125
Species: Hu
Applications: WB, ICC/IF
AF5276
Species: Hu
Applications: WB, IHC
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS932
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Serotonin N-acetyltransferase Partial Recombinant Protein (H00000015-Q01) (0)

There are no publications for Serotonin N-acetyltransferase Partial Recombinant Protein (H00000015-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serotonin N-acetyltransferase Partial Recombinant Protein (H00000015-Q01) (0)

There are no reviews for Serotonin N-acetyltransferase Partial Recombinant Protein (H00000015-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serotonin N-acetyltransferase Partial Recombinant Protein (H00000015-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Serotonin N-acetyltransferase Products

Bioinformatics Tool for Serotonin N-acetyltransferase Partial Recombinant Protein (H00000015-Q01)

Discover related pathways, diseases and genes to Serotonin N-acetyltransferase Partial Recombinant Protein (H00000015-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serotonin N-acetyltransferase Partial Recombinant Protein (H00000015-Q01)

Discover more about diseases related to Serotonin N-acetyltransferase Partial Recombinant Protein (H00000015-Q01).
 

Pathways for Serotonin N-acetyltransferase Partial Recombinant Protein (H00000015-Q01)

View related products by pathway.

PTMs for Serotonin N-acetyltransferase Partial Recombinant Protein (H00000015-Q01)

Learn more about PTMs related to Serotonin N-acetyltransferase Partial Recombinant Protein (H00000015-Q01).
 

Research Areas for Serotonin N-acetyltransferase Partial Recombinant Protein (H00000015-Q01)

Find related products by research area.

Blogs on Serotonin N-acetyltransferase

There are no specific blogs for Serotonin N-acetyltransferase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMAL1 Antibody
NB100-2288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Serotonin N-acetyltransferase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AANAT