Septin-7 Antibody - BSA Free

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85731] - Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85731] - Staining of human cerebral cortex, lymph node, skeletal muscle and testis using Anti-SEPT7 antibody NBP1-85731 (A) shows similar protein distribution across tissues to independent antibody NBP1-85730 (B).

Immunocytochemistry/Immunofluorescence: Septin-7 Antibody [NBP1-85731] - Staining of human cell line A-431 shows localization to nucleoli, plasma membrane & actin filaments. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85731] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Western Blot: Septin-7 Antibody [NBP1-85731] - Analysis in human cell line U-2 OS.

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85731] - Staining of human testis shows moderate positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85731] - Staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85731] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85731] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell line U-2 OS.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Septin-7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Septin-7 Antibody - BSA Free (NBP1-85731) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEPTIN7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  Septin-7 Protein (NBP1-85731PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Septin-7 Antibody - BSA Free

• CDC10 cell division cycle 10 homolog (S. cerevisiae)
• CDC10 cell division cycle 10 homolog
• CDC10 protein homolog
• CDC10S. cerevisiae, homolog)
• Nbla02942
• septin 7
• septin-7

Background

This gene encodes a protein that is highly similar to the CDC10 protein of Saccharomyces cerevisiae. The protein also shares similarity with Diff 6 of Drosophila and with H5 of mouse. Each of these similar proteins, including the yeast CDC10, contains a GTP-binding motif. The yeast CDC10 protein is a structural component of the 10 nm filament which lies inside the cytoplasmic membrane and is essential for cytokinesis. Although the exact function of this gene has not yet been determined, its high similarity to yeast CDC10 and the high conservative nature of eukaryotic cell cycle machinery suggest a similar role to that of its yeast counterpart. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEPTIN7