![Western Blot: Septin-6 Antibody [NBP1-89626] - Analysis in human cell line SH-SY5Y.](http://images.novusbio.com/fullsize2/Septin-6-Antibody-Western-Blot-NBP1-89626-img0007.jpg "Western Blot: Septin-6 Antibody [NBP1-89626] - Analysis in human cell line SH-SY5Y.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVLHTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSEL |
| Predicted Species | Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SEPT6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Western-Blot-H00001731-M03-img0004.jpg)
-Immunocytochemistry-Immunofluorescence-H00001731-M03-img0001.jpg)
-Immunoprecipitation-H00001731-M03-img0002.jpg)
| Publication using NBP1-89626 | Applications | Species |
|---|---|---|
| Coulombe K, Kerdiles O, Tremblay C et al. Impact of DHA intake in a mouse model of synucleinopathy. Exp. Neurol. 2017-12-08 [PMID: 29229294] (Mouse) | Mouse |
Secondary Antibodies |
Isotype Controls |
Diseases for Septin-6 Antibody (NBP1-89626)Discover more about diseases related to Septin-6 Antibody (NBP1-89626).
| Pathways for Septin-6 Antibody (NBP1-89626)View related products by pathway.
|
PTMs for Septin-6 Antibody (NBP1-89626)Learn more about PTMs related to Septin-6 Antibody (NBP1-89626).
| Research Areas for Septin-6 Antibody (NBP1-89626)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SEPT6 |
![Immunohistochemistry-Paraffin: Septin-6 Antibody [NBP1-89626] - Staining of human lymph node shows cytoplasmic positivity in reaction center cells.](http://images.novusbio.com/fullsize2/Septin-6-Antibody-Immunohistochemistry-Paraffin-NBP1-89626-img0006.jpg "Immunohistochemistry-Paraffin: Septin-6 Antibody [NBP1-89626] - Staining of human lymph node shows cytoplasmic positivity in reaction center cells.")
![Western Blot: Septin-6 Antibody [NBP1-89626] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/Septin-6-Antibody-Western-Blot-NBP1-89626-img0008.jpg "Western Blot: Septin-6 Antibody [NBP1-89626] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SHCF_2841.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_CF_342.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-shcf_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-cf-sec-mals-1042023155813.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")