Septin-1 Antibody


Western Blot: Septin-1 Antibody [NBP1-84251] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunohistochemistry-Paraffin: Septin-1 Antibody [NBP1-84251] - Staining of human spleen shows strong cytoplasmic positivity in cells in white pulp.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Septin-1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:EVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Septin-1 Protein (NBP1-84251PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Septin-1 Antibody

  • differentiation 6 (deoxyguanosine triphosphate triphosphohydrolase)
  • LARP
  • Peanut-like protein 3
  • PNUTL3MGC20394
  • septin 1
  • septin-1
  • Serologically defined breast cancer antigen NY-BR-24


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IP
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PLA
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Septin-1 Antibody (NBP1-84251) (0)

There are no publications for Septin-1 Antibody (NBP1-84251).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-1 Antibody (NBP1-84251) (0)

There are no reviews for Septin-1 Antibody (NBP1-84251). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Septin-1 Antibody (NBP1-84251) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Septin-1 Products

Bioinformatics Tool for Septin-1 Antibody (NBP1-84251)

Discover related pathways, diseases and genes to Septin-1 Antibody (NBP1-84251). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Septin-1 Antibody (NBP1-84251)

Discover more about diseases related to Septin-1 Antibody (NBP1-84251).

Pathways for Septin-1 Antibody (NBP1-84251)

View related products by pathway.

PTMs for Septin-1 Antibody (NBP1-84251)

Learn more about PTMs related to Septin-1 Antibody (NBP1-84251).

Research Areas for Septin-1 Antibody (NBP1-84251)

Find related products by research area.

Blogs on Septin-1

There are no specific blogs for Septin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Septin-1 Antibody and receive a gift card or discount.


Gene Symbol SEPT1