SEPHS1 Antibody (4D3-6A2)

Images

 
Sandwich ELISA: SEPHS1 Antibody (4D3-6A2) [H00022929-M01] - Detection limit for recombinant GST tagged SEPHS1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
4D3-6A2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SEPHS1 Antibody (4D3-6A2) Summary

Immunogen
SEPHS1 (AAH00941, 1 a.a. ~ 393 a.a) full length recombinant protein with GST tag.MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLL ESLQENHFQEDEQFLGAVMPRLGIGMDTCVIPLRHGGLSLVQ TTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLL GVSNKMTDRERDKVMPLIIQGFKDAAEEAGTSVTGGQTVLNP WIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVA VHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMA
Specificity
SEPHS1 - selenophosphate synthetase 1
Isotype
IgG Mix Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SEPHS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SEPHS1 Antibody (4D3-6A2)

  • EC 2.7.9.3
  • MGC4980
  • SELD
  • Selenium donor protein 1
  • Selenophosphate synthase 1
  • selenophosphate synthetase 1 +E9a
  • selenophosphate synthetase 1 delta E2
  • selenophosphate synthetase 1 delta E8
  • selenophosphate synthetase 1 major
  • selenophosphate synthetase 1
  • SPS1selenophosphate synthetase 1 +E9
  • water dikinase 1

Background

This protein encodes an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13293
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83992
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
H00022929-M01
Species: Hu
Applications: ELISA

Publications for SEPHS1 Antibody (H00022929-M01) (0)

There are no publications for SEPHS1 Antibody (H00022929-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEPHS1 Antibody (H00022929-M01) (0)

There are no reviews for SEPHS1 Antibody (H00022929-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SEPHS1 Antibody (H00022929-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEPHS1 Products

Bioinformatics Tool for SEPHS1 Antibody (H00022929-M01)

Discover related pathways, diseases and genes to SEPHS1 Antibody (H00022929-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEPHS1 Antibody (H00022929-M01)

Discover more about diseases related to SEPHS1 Antibody (H00022929-M01).
 

Pathways for SEPHS1 Antibody (H00022929-M01)

View related products by pathway.

Research Areas for SEPHS1 Antibody (H00022929-M01)

Find related products by research area.

Blogs on SEPHS1

There are no specific blogs for SEPHS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEPHS1 Antibody (4D3-6A2) and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPHS1
Entrez
OMIM
Uniprot