SENP6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SENP6 Antibody [NBP1-82958] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SENP6 Antibody [NBP1-82958] - Staining of human vulva/anal skin shows strong nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SENP6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTPPLSPASKKCLTHLEDLQRNCRQAITLNESTGPLLRTSIHQNSGGQKSQNTGLTTKKFYGNNVEKVPIDIIVNCDDSKHTYLQTNGKVILPGAKIPKITNLKERKTSLSDLNDPIILSSDDDDDNDRTNRRESISPQPADSACSSPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SENP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SENP6 Protein (NBP1-82958PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SENP6 Antibody

  • EC 3.4.22.-
  • KIAA0797FLJ11887
  • Sentrin/SUMO-specific protease SENP6
  • sentrin-specific protease 6
  • SSP1KIAA0389
  • SUMO1/sentrin specific peptidase 6,2810017C20Rik
  • SUMO1/sentrin specific protease 6
  • SUMO-1-specific protease 1
  • SUSP1FLJ11355

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
NB100-56444
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-24651
Species: Hu, Mu, Eq, Pm
Applications: WB
NBP2-03852
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56405
Species: Hu, Mu
Applications: WB, Simple Western
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-56590
Species: Hu, Rt
Applications: WB, IHC, IF
NBP1-83060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
H00079092-T01
Species: Hu
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
H00006047-A01
Species: Hu
Applications: WB, ELISA
NBP2-37956
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30865
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07087
Species: Hu

Publications for SENP6 Antibody (NBP1-82958) (0)

There are no publications for SENP6 Antibody (NBP1-82958).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SENP6 Antibody (NBP1-82958) (0)

There are no reviews for SENP6 Antibody (NBP1-82958). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SENP6 Antibody (NBP1-82958) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SENP6 Products

Bioinformatics Tool for SENP6 Antibody (NBP1-82958)

Discover related pathways, diseases and genes to SENP6 Antibody (NBP1-82958). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SENP6 Antibody (NBP1-82958)

Discover more about diseases related to SENP6 Antibody (NBP1-82958).
 

Pathways for SENP6 Antibody (NBP1-82958)

View related products by pathway.

PTMs for SENP6 Antibody (NBP1-82958)

Learn more about PTMs related to SENP6 Antibody (NBP1-82958).

Blogs on SENP6

There are no specific blogs for SENP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SENP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SENP6