SENP6 Antibody

Immunocytochemistry/Immunofluorescence: SENP6 Antibody [NBP1-82958] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: SENP6 Antibody [NBP1-82958] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: SENP6 Antibody [NBP1-82958] - Staining of human testis shows strong nuclear positivity in Leydig cells.

Immunohistochemistry-Paraffin: SENP6 Antibody [NBP1-82958] - Staining of human prostate shows weak positivity in nucleoli in glandular cells.

Immunohistochemistry-Paraffin: SENP6 Antibody [NBP1-82958] - Staining of human skin shows strong positivity in nucleoli in squamous epithelial cells.

Product Discontinued

SENP6 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PTPPLSPASKKCLTHLEDLQRNCRQAITLNESTGPLLRTSIHQNSGGQKSQNTGLTTKKFYGNNVEKVPIDIIVNCDDSKHTYLQTNGKVILPGAKIPKITNLKERKTSLSDLNDPIILSSDDDDDNDRTNRRESISPQPADSACSSPA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SENP6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SENP6 Antibody

• EC 3.4.22.-
• KIAA0797FLJ11887
• Sentrin/SUMO-specific protease SENP6
• sentrin-specific protease 6
• SSP1KIAA0389
• SUMO1/sentrin specific peptidase 6,2810017C20Rik
• SUMO1/sentrin specific protease 6
• SUMO-1-specific protease 1
• SUSP1FLJ11355

Background

Ubiquitin-like molecules (UBLs), such as SUMO1 (UBL1; MIM 601912), are structurally related to ubiquitin (MIM 191339) and can be ligated to target proteins in a similar manner as ubiquitin. However, covalent attachment of UBLs does not result in degradation of the modified proteins. SUMO1 modification is implicated in the targeting of RANGAP1 (MIM 602362) to the nuclear pore complex, as well as in stabilization of I-kappa-B-alpha (NFKBIA; MIM 164008) from degradation by the 26S proteasome. Like ubiquitin, UBLs are synthesized as precursor proteins, with 1 or more amino acids following the C-terminal glycine-glycine residues of the mature UBL protein. Thus, the tail sequences of the UBL precursors need to be removed by UBL-specific proteases, such as SENP6, prior to their conjugation to target proteins (Kim et al., 2000 [PubMed 10799485]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SENP6 Antibody (NBP1-82958)(1)

Publication using NBP1-82958

• Haahr P, Borgermann N, Guo X et al. ZUFSP Deubiquitylates K63-Linked Polyubiquitin Chains to Promote Genome Stability. Mol. Cell. 2018-03-09 [PMID: 29576528] (Human)

Bioinformatics

• Gene Symbol: SENP6