Semaphorin 7A Recombinant Protein Antigen

Images

 
There are currently no images for Semaphorin 7A Protein (NBP1-86555PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Semaphorin 7A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SEMA7A.

Source: E. coli

Amino Acid Sequence: QDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SEMA7A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86555.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Semaphorin 7A Recombinant Protein Antigen

  • CD108 antigen
  • CD108
  • CD108MGC126696
  • CDw108
  • H-SEMA-K1
  • H-Sema-L
  • JMH blood group antigen
  • JMH
  • John-Milton-Hargen human blood group Ag
  • MGC126692
  • sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, (semaphorin)7A (JMH blood group)
  • sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, (semaphorin)7A
  • sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, 7A
  • Sema K1
  • Sema L
  • Sema7A
  • SEMAK1
  • SEMAL
  • SEMALJohn Milton Hagen blood group H-Sema K1
  • Semaphorin 7A
  • semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
  • semaphorin K1
  • semaphorin L
  • semaphorin-7A
  • semaphorin-K1
  • semaphorin-L

Background

required for central and peripheral axon growth and is required for proper axon tract formation during embryonic development. Semaphorin 7a is also involved in modulating immune function. Semaphorin 7a expression is highest in the brain and increases in late embryonic and postnatal stages. The Semaphorins constitute a large family of secreted and membrane-tethered cell signaling molecules. They have functions in neural development, immunology, cardiac growth, vascular development, lung morphogenesis and axial bone patterning. Semaphorins are defined by the presence of a conserved Sema domain at the N-terminus. These proteins can be classified into eight classes depending on their structure and species origin. Classes 3 through 7 are found in vertebrates; class 3 are secreted, class 7 are GPI-anchored, and class 4 through 6 are transmembrane proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
AF2009
Species: Hu
Applications: ICC, IHC
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF5375
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
AF5235
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
1250-S3
Species: Hu
Applications: BA, BA
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
AF3749
Species: Hu
Applications: IHC, WB
AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
NB500-330
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr,  IHC-P, IP
AF566
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
233-FB
Species: Hu
Applications: BA
AF7895
Species: Hu
Applications: IHC, WB
AF4075
Species: Mu, Rt
Applications: IHC, WB
NB100-2218
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-86555PEP
Species: Hu
Applications: AC

Publications for Semaphorin 7A Protein (NBP1-86555PEP) (0)

There are no publications for Semaphorin 7A Protein (NBP1-86555PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 7A Protein (NBP1-86555PEP) (0)

There are no reviews for Semaphorin 7A Protein (NBP1-86555PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Semaphorin 7A Protein (NBP1-86555PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Semaphorin 7A Products

Research Areas for Semaphorin 7A Protein (NBP1-86555PEP)

Find related products by research area.

Blogs on Semaphorin 7A

There are no specific blogs for Semaphorin 7A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Semaphorin 7A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA7A