Semaphorin 4A Recombinant Protein Antigen

Images

 
There are currently no images for Semaphorin 4A Recombinant Protein Antigen (NBP2-56706PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Semaphorin 4A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Semaphorin 4A.

Source: E. coli

Amino Acid Sequence: PNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPEASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SEMA4A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56706. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Semaphorin 4A Recombinant Protein Antigen

  • CORD10
  • RP35
  • Sema B
  • sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4A
  • SEMA4A
  • SEMAB
  • Semaphorin 4A
  • semaphorin-4A
  • semaphorin-B
  • SEMB
  • SEMBFLJ12287

Background

Semaphorins are a family of cell surface and secreted proteins that are conserved from insects to humans. Members of this family of proteins are approximately 750 amino acids in length (including signal sequences) and are defined by a conserved extracellular "Semaphorin" domain of approximately 500 amino acids containing 14-16 cysteines, blocks of conserved sequences and no obvious repeats. The transmembrane semaphorins are characterized by an additional 80 amino acid transmembrane domain and an 80-110 amino acid cytoplasmic domain. Secreted and cell-bound semaphorins chemically attract and repel the growth of neural axons, guiding the development of intricate networks of neural tissue. Semaphorin 4A (SEMA4A), also designated Semaphorin B, is a type I membrane protein. The SEMA4A gene encoding the protein localizes to chromosome 1q22. SEMA4A provides signals to specify territories inaccessible for growing neurons, inhibiting axonal extension.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5235
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-38533
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
DVE00
Species: Hu
Applications: ELISA
MAB46941
Species: Hu
Applications: IHC, WB
AF4160
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
1250-S3
Species: Hu
Applications: BA, BA
AF3749
Species: Hu
Applications: IHC, WB
AF1885
Species: Mu
Applications: IHC, WB
AF1885
Species: Mu
Applications: IHC, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
664-LI
Species: Hu
Applications: BA
NBP3-38160
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
AF5329
Species: Hu
Applications: IHC, KO, WB
AF8520
Species: Hu
Applications: ICC, IP, KO, Simple Western, WB
NBP2-56706PEP
Species: Hu
Applications: AC

Publications for Semaphorin 4A Recombinant Protein Antigen (NBP2-56706PEP) (0)

There are no publications for Semaphorin 4A Recombinant Protein Antigen (NBP2-56706PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 4A Recombinant Protein Antigen (NBP2-56706PEP) (0)

There are no reviews for Semaphorin 4A Recombinant Protein Antigen (NBP2-56706PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Semaphorin 4A Recombinant Protein Antigen (NBP2-56706PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Semaphorin 4A Products

Research Areas for Semaphorin 4A Recombinant Protein Antigen (NBP2-56706PEP)

Find related products by research area.

Blogs on Semaphorin 4A

There are no specific blogs for Semaphorin 4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Semaphorin 4A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA4A