Semaphorin 3F Antibody

Images

 
Immunohistochemistry-Paraffin: Semaphorin 3F Antibody [NBP1-90665] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Semaphorin 3F Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPREAPGAPRSPEPQDQKKPRNRRHHPPDT
Specificity
Specificity of human, mouse Semaphorin 3F antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEMA3F
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publications using
NBP1-90665 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23871637). Mouse reactivity reported in scientific literature (PMID: 26447612).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Semaphorin 3F Antibody

  • sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F
  • sema domain, immunoglobulin domain (Ig), short basic domain, secreted, 3F
  • sema III/F
  • sema IV
  • Sema3F
  • SEMA4
  • SEMA-IV
  • SEMAK
  • Semaphorin 3F
  • semaphorin III/F
  • semaphorin IV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2215
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, Block, CyTOF-ready
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-82527
Species: Hu, Mu
Applications: IHC, IHC-P
AF4075
Species: Mu, Rt
Applications: WB, IHC
AF7109
Species: Mu
Applications: WB, IHC
MAB1728
Species: Hu, Mu
Applications: WB, IHC, ICC
AF1146
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85128
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-76899
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF3239
Species: Hu, Mu
Applications: WB, IHC, ICC

Publications for Semaphorin 3F Antibody (NBP1-90665)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for Semaphorin 3F Antibody (NBP1-90665) (0)

There are no reviews for Semaphorin 3F Antibody (NBP1-90665). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Semaphorin 3F Antibody (NBP1-90665) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Semaphorin 3F Products

Bioinformatics Tool for Semaphorin 3F Antibody (NBP1-90665)

Discover related pathways, diseases and genes to Semaphorin 3F Antibody (NBP1-90665). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 3F Antibody (NBP1-90665)

Discover more about diseases related to Semaphorin 3F Antibody (NBP1-90665).
 

Pathways for Semaphorin 3F Antibody (NBP1-90665)

View related products by pathway.

PTMs for Semaphorin 3F Antibody (NBP1-90665)

Learn more about PTMs related to Semaphorin 3F Antibody (NBP1-90665).

Blogs on Semaphorin 3F

There are no specific blogs for Semaphorin 3F, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Semaphorin 3F Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA3F
COVID-19 update