Semaphorin 3F Antibody

Immunohistochemistry-Paraffin: Semaphorin 3F Antibody [NBP1-90665] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Discontinued

Semaphorin 3F Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPREAPGAPRSPEPQDQKKPRNRRHHPPDT
• Predicted Species: Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEMA3F
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23871637). Mouse reactivity reported in scientific literature (PMID: 26447612).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Semaphorin 3F Antibody

• sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F
• sema domain, immunoglobulin domain (Ig), short basic domain, secreted, 3F
• sema III/F
• sema IV
• Sema3F
• SEMA4
• SEMA-IV
• SEMAK
• Semaphorin 3F
• semaphorin III/F
• semaphorin IV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Semaphorin 3F Antibody (NBP1-90665)(2)

Publications using NBP1-90665

• Bollard J, Massoma P, Vercherat C et al. The axon guidance molecule semaphorin 3F is a negative regulator of tumor progression and proliferation in ileal neuroendocrine tumors. Oncotarget 2015-11-03 [PMID: 26447612] (IF/IHC, Mouse)
• Masiero M, Simoes FC, Han HD et al. A core human primary tumor angiogenesis signature identifies the endothelial orphan receptor ELTD1 as a key regulator of angiogenesis. Cancer Cell 2013-08-12 [PMID: 23871637] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: SEMA3F