Semaphorin 3A Antibody (5G9) Summary
| Immunogen |
SEMA3A (NP_006071, 672 a.a. ~ 770 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRRTHEFERAPRS |
| Specificity |
SEMA3A - sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
SEMA3A |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Reactivity Notes
Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Semaphorin 3A Antibody (5G9)
Background
This gene is a member of the semaphorin family and encodes a protein with an Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a Sema domain. This secreted protein can function as either a chemorepulsive agent, inhibiting axonal outgrowth, or as a chemoattractive agent, stimulating the growth of apical dendrites. In both cases, the protein is vital for normal neuronal pattern development. Increased expression of this protein is associated with schizophrenia and is seen in a variety of human tumor cell lines. Also, aberrant release of this protein is associated with the progression of Alzheimer's disease.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: ELISA
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: Bind
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: IHC, WB
Publications for Semaphorin 3A Antibody (H00010371-M01) (0)
There are no publications for Semaphorin 3A Antibody (H00010371-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Semaphorin 3A Antibody (H00010371-M01) (0)
There are no reviews for Semaphorin 3A Antibody (H00010371-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Semaphorin 3A Antibody (H00010371-M01). (Showing 1 - 1 of 1 FAQ).
-
Do you know the a.a. sequence of the recombinant Sema3A immunogen where the antibody binds, or at least which portion of the protein (N- or C- terminal, center)? We are working with human vitreous samples, and there is no actual data on expected concentrations of Sema3A in the patients. It would be very relevant for us to know the detection limit of this antibody.
- The immunogen used to generate H00010371-M01 was a partial recombinant protein corresponding to amino acids 672-770 of NP_006071. This is at the C-terminus of the SEMA3A protein. We do not have any epitope mapping data for this antibody. One of our images for H00010371-M01 is a recombinant protein sandwich ELISA analysis, where we state that 'Detection limit for recombinant GST tagged SEMA3A is 0.1 ng/ml as a capture antibody'.
Secondary Antibodies
| |
Isotype Controls
|
Additional Semaphorin 3A Products
Research Areas for Semaphorin 3A Antibody (H00010371-M01)
Find related products by research area.
|
Blogs on Semaphorin 3A