![Immunohistochemistry-Paraffin: SDR16C5 Antibody [NBP1-87150] - Analysis in human skin and prostate tissues. Corresponding SDR16C5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SDR16C5-Antibody-Immunohistochemistry-Paraffin-NBP1-87150-img0009.jpg "Immunohistochemistry-Paraffin: SDR16C5 Antibody [NBP1-87150] - Analysis in human skin and prostate tissues. Corresponding SDR16C5 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SDR16C5 Antibody - BSA Free (NBP1-87150) is a polyclonal antibody validated for use in IHC and WB. Anti-SDR16C5 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYLGILHAMDGFVDQKKKL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SDR16C5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-87150 | Applications | Species |
|---|---|---|
| Baras AS, Gandhi N, Munari E et al. Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma. PLoS One 2015-01-01 [PMID: 26230923] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SDR16C5 |
![Western Blot: SDR16C5 Antibody [NBP1-87150] - Analysis in control (vector only transfected HEK293T lysate) and SDR16C5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/SDR16C5-Antibody-Western-Blot-NBP1-87150-img0008.jpg "Western Blot: SDR16C5 Antibody [NBP1-87150] - Analysis in control (vector only transfected HEK293T lysate) and SDR16C5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: SDR16C5 Antibody [NBP1-87150] - Staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/SDR16C5-Antibody-Immunohistochemistry-Paraffin-NBP1-87150-img0014.jpg "Immunohistochemistry-Paraffin: SDR16C5 Antibody [NBP1-87150] - Staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: SDR16C5 Antibody [NBP1-87150] - Staining of human lung cancer, adenocarcinoma shows strong cytoplasmic positivity in tumor cells.](http://images.novusbio.com/fullsize/SDR16C5-Antibody-Immunohistochemistry-Paraffin-NBP1-87150-img0010.jpg "Immunohistochemistry-Paraffin: SDR16C5 Antibody [NBP1-87150] - Staining of human lung cancer, adenocarcinoma shows strong cytoplasmic positivity in tumor cells.")
![Immunohistochemistry-Paraffin: SDR16C5 Antibody [NBP1-87150] - Staining of human prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/SDR16C5-Antibody-Immunohistochemistry-Paraffin-NBP1-87150-img0011.jpg "Immunohistochemistry-Paraffin: SDR16C5 Antibody [NBP1-87150] - Staining of human prostate shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: SDR16C5 Antibody [NBP1-87150] - Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/SDR16C5-Antibody-Immunohistochemistry-Paraffin-NBP1-87150-img0012.jpg "Immunohistochemistry-Paraffin: SDR16C5 Antibody [NBP1-87150] - Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: SDR16C5 Antibody [NBP1-87150] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SDR16C5-Antibody-Immunohistochemistry-Paraffin-NBP1-87150-img0013.jpg "Immunohistochemistry-Paraffin: SDR16C5 Antibody [NBP1-87150] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")