SCP3/SYCP3 Antibody

Images

 
Immunohistochemistry-Paraffin: SCP3/SYCP3 Antibody [NBP2-54713] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SCP3/SYCP3 Antibody [NBP2-54713] - Staining of human endometrium shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SCP3/SYCP3 Antibody [NBP2-54713] - Staining in human testis and endometrium tissues using anti-SYCP3 antibody. Corresponding SYCP3 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SCP3/SYCP3 Antibody Summary

Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids: KYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYCP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SCP3/SYCP3 Recombinant Protein Antigen (NBP2-54713PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCP3/SYCP3 Antibody

  • COR1
  • MGC71888
  • SCP3 chromosome 3 open reading frame 8
  • SCP3 COR1
  • SCP3
  • SCP-3
  • SYCP3
  • synaptonemal complex protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-229
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-03456
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB100-56648
Species: Hu, Mu, Rt
Applications: WB
NBP2-94045
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
AF2030
Species: Hu
Applications: IHC, WB
NB100-181
Species: Hu, Mu
Applications: IP, WB
NBP1-98492
Species: Hu, Mu
Applications: ICC, KO, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-207
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-2437
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PCR, PEP-ELISA, WB
NBP2-02667
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32283
Species: Hu, Mu, Rt
Applications: WB
NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NBP1-87144
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85958
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
AF2288
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-89966
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SCP3/SYCP3 Antibody (NBP2-54713) (0)

There are no publications for SCP3/SYCP3 Antibody (NBP2-54713).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCP3/SYCP3 Antibody (NBP2-54713) (0)

There are no reviews for SCP3/SYCP3 Antibody (NBP2-54713). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SCP3/SYCP3 Antibody (NBP2-54713) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCP3/SYCP3 Products

Bioinformatics Tool for SCP3/SYCP3 Antibody (NBP2-54713)

Discover related pathways, diseases and genes to SCP3/SYCP3 Antibody (NBP2-54713). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCP3/SYCP3 Antibody (NBP2-54713)

Discover more about diseases related to SCP3/SYCP3 Antibody (NBP2-54713).
 

Pathways for SCP3/SYCP3 Antibody (NBP2-54713)

View related products by pathway.

PTMs for SCP3/SYCP3 Antibody (NBP2-54713)

Learn more about PTMs related to SCP3/SYCP3 Antibody (NBP2-54713).
 

Research Areas for SCP3/SYCP3 Antibody (NBP2-54713)

Find related products by research area.

Blogs on SCP3/SYCP3.

SCP3: A Key to Meiotic Recombination, Sterility and Cancer
Synaptonemal Complex Protein 3 (SCP3), which is a protein present in the synaptonemal complex which is responsible for pairing, synapsis, and recombination of homologous chromosomes during meiosis. Meiosis, in basic terms, is where germ cells divide t...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCP3/SYCP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYCP3