SCO2 Antibody

Images

 
Western Blot: SCO2 Antibody [H00009997-B01P] - Analysis of SCO2 expression in transfected 293T cell line by SCO2 polyclonal antibody. Lane 1: SCO2 transfected lysate(29.26 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SCO2 Antibody Summary

Immunogen
SCO2 (NP_005129.1, 1 a.a. - 266 a.a.) full-length human protein. MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS
Specificity
SCO2 - SCO cytochrome oxidase deficient homolog 2 (yeast),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SCO2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SCO2 Antibody

  • cytochrome oxidase deficient homolog 2
  • MGC125823
  • MGC125825
  • protein SCO2 homolog, mitochondrial
  • SCO cytochrome oxidase deficient homolog 2 (yeast)
  • yeast) homolog 2

Background

Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytochrome c oxidase), enable subunits 1 and 2 to be incorporated into the holoprotein. This gene is the human homolog of the yeast SCO2 gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
H00001351-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-87073
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-94912
Species: Hu, Mu, Rt
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-99469
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, IP, WB
NBP1-86322
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF7629
Species: Hu
Applications: ICC, IHC, WB
H00001353-B02P
Species: Hu
Applications: ICC/IF, WB
NBP1-59560
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-59376
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-402
Species: Ca, Hu, Mu, Po, Rt, Xp, Ze
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-360
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
NBP2-20439
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-1936
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
H00006607-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-76798
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
H00009997-B01P
Species: Hu
Applications: WB

Publications for SCO2 Antibody (H00009997-B01P) (0)

There are no publications for SCO2 Antibody (H00009997-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCO2 Antibody (H00009997-B01P) (0)

There are no reviews for SCO2 Antibody (H00009997-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCO2 Antibody (H00009997-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCO2 Products

Bioinformatics Tool for SCO2 Antibody (H00009997-B01P)

Discover related pathways, diseases and genes to SCO2 Antibody (H00009997-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCO2 Antibody (H00009997-B01P)

Discover more about diseases related to SCO2 Antibody (H00009997-B01P).
 

Pathways for SCO2 Antibody (H00009997-B01P)

View related products by pathway.

PTMs for SCO2 Antibody (H00009997-B01P)

Learn more about PTMs related to SCO2 Antibody (H00009997-B01P).
 

Research Areas for SCO2 Antibody (H00009997-B01P)

Find related products by research area.

Blogs on SCO2

There are no specific blogs for SCO2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCO2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCO2
Entrez
Uniprot