SCO2 Antibody - Azide and BSA Free

Western Blot: SCO2 Antibody [H00009997-B01P] - Analysis of SCO2 expression in transfected 293T cell line by SCO2 polyclonal antibody. Lane 1: SCO2 transfected lysate(29.26 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SCO2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SCO2 Antibody - Azide and BSA Free (H00009997-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SCO2 (NP_005129.1, 1 a.a. - 266 a.a.) full-length human protein. MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS
• Specificity: SCO2 - SCO cytochrome oxidase deficient homolog 2 (yeast),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: SCO2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SCO2 Antibody - Azide and BSA Free

• cytochrome oxidase deficient homolog 2
• MGC125823
• MGC125825
• protein SCO2 homolog, mitochondrial
• SCO cytochrome oxidase deficient homolog 2 (yeast)
• yeast) homolog 2

Background

Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytochrome c oxidase), enable subunits 1 and 2 to be incorporated into the holoprotein. This gene is the human homolog of the yeast SCO2 gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCO2
• Entrez:
  • 9997(Human)
• Uniprot:
  • NP_005129(Human)