Scn2b Antibody - BSA Free

Western Blot: Scn2b Antibody [NBP2-82340] - Host: Rabbit. Target Name: SCN2B. Sample Tissue: Mouse Thymus lysates. Antibody Dilution: 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Scn2b Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of Mouse SCN2B. Peptide sequence: TVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKMDG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCN2B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Scn2b Antibody - BSA Free

• neuronal voltage-gated sodium channel beta 2 subunit
• sodium channel beta 2 subunit
• sodium channel subunit beta-2
• sodium channel, voltage-gated, type II, beta polypeptide
• sodium channel, voltage-gated, type II, beta

Background

Voltage-gated sodium channels (NaV) are responsible for action potential initiation and propagation in excitable cells, including nerve, muscle, and neuroendocrine cell types. They are also expressed at low levels in non-excitable cells, where their physiological role is unclear. Structurally, Nav channels are composed of one pore-forming alpha-subunit, which may be associated with either one or more beta-subunits. alpha-subunits are composed for four homologous domains, each of which contains six transmembrane segments. The fourth transmembrane loop (S4) acts as the 'voltage sensor' and is activated by changes in membrane potential. S4 is also involved in channel gating.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCN2B