SCN11A Antibody


Immunohistochemistry: SCN11A Antibody [NBP2-48665] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

SCN11A Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PLKKLYEPIVTTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD
Specificity of human SCN11A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SCN11A Recombinant Protein Antigen (NBP2-48665PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SCN11A Antibody

  • hNaN
  • NaN
  • Nav1.9
  • Peripheral nerve sodium channel 5
  • PN5
  • SCN12A
  • SNS2
  • SNS-2
  • sodium channel, voltage-gated, type XI, alpha polypeptide
  • sodium channel, voltage-gated, type XI, alpha subunit
  • sodium channel, voltage-gated, type XII, alpha
  • voltage-gated sodium channel Nav1.9
  • Voltage-gated sodium channel subunit alpha Nav1.9
  • voltage-gated, type XII, alpha polypeptide


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
Species: Hu
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Ca, Eq
Species: Rt

Publications for SCN11A Antibody (NBP2-48665) (0)

There are no publications for SCN11A Antibody (NBP2-48665).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCN11A Antibody (NBP2-48665) (0)

There are no reviews for SCN11A Antibody (NBP2-48665). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SCN11A Antibody (NBP2-48665) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SCN11A Antibody (NBP2-48665)

Discover related pathways, diseases and genes to SCN11A Antibody (NBP2-48665). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCN11A Antibody (NBP2-48665)

Discover more about diseases related to SCN11A Antibody (NBP2-48665).

Pathways for SCN11A Antibody (NBP2-48665)

View related products by pathway.

PTMs for SCN11A Antibody (NBP2-48665)

Learn more about PTMs related to SCN11A Antibody (NBP2-48665).

Blogs on SCN11A

There are no specific blogs for SCN11A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SCN11A Antibody and receive a gift card or discount.


Gene Symbol SCN11A