SCL/Tal1 Antibody

Immunocytochemistry/Immunofluorescence: SCL/Tal1 Antibody [NBP2-56907] - Staining of human cell line CACO-2 shows localization to nucleus. Antibody staining is shown in green.

Product Discontinued

SCL/Tal1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPHTKVVRRI
• Predicted Species: Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SCL/Tal1 Antibody

• BHLHA17
• bHLHa17tal-1
• Class A basic helix-loop-helix protein 17
• SCL
• SCLT-cell acute lymphocytic leukemia protein 1
• Stem Cell Protein
• Tal1
• TAL-1
• T-cell acute lymphocytic leukemia 1
• T-cell leukemia/lymphoma protein 5
• TCL5
• TCL5tal-1 product

Background

Implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. Serves as a positive regulator of erythroid differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAL1