SCIN Antibody

Images

 
Western Blot: SCIN Antibody [H00085477-B01P] - Analysis of SCIN expression in human pancreas.
Western Blot: SCIN Antibody [H00085477-B01P] - Analysis of SCIN expression in human kidney.
Western Blot: SCIN Antibody [H00085477-B01P] - Analysis of SCIN expression in transfected 293T cell line by SCIN polyclonal antibody. Lane 1: SCIN transfected lysate(51.48 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SCIN Antibody Summary

Immunogen
SCIN (NP_149119.1, 1 a.a. - 468 a.a.) full-length human protein. MAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHGAAKQIFVWKGKDANPQERKAAMKTAEEFLQQMNYSKNTQIQVLPEGGETPIFKQFFKDWRDKDQSDGFGKVYVTEKVAQIKQIPFDASKLHSSPQMAAQHNMVDDGSGKVEIWRVENNGRIQVDQNSYGEFYGGDCYIILYTYPRGQIIYTWQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPVHLLSLFKDKPLIIYKNGTSKKGGQAPAPPTRLFQVRRNLASITRIVEVDVDANSLNSNDVFVLKLPQNSGYIWVGKGASQEEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQTSPLLETQAEDHPPRLYGCSNKTGRFVIEEIPGEFTQDDLAEDDVMLLDAWEQIFIWIGKDANEVEKKESLKSAKMYLETDPSGRDKRTPIVIIKQGHEPPTFTGWFLGWDSSKW
Specificity
SCIN - scinderin,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SCIN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SCIN Antibody

  • KIAA1905adseverin
  • Scinderin

Background

Ca(2+)-dependent actin filament-severing protein that is presumed to have a regulatory function in exocytosisby affecting the organization of the microfilament network underneath the plasma membrane. In vitro, also has barbedend capping and nucleating activities in the presence of Ca(2+)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SCIN Antibody (H00085477-B01P) (0)

There are no publications for SCIN Antibody (H00085477-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCIN Antibody (H00085477-B01P) (0)

There are no reviews for SCIN Antibody (H00085477-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCIN Antibody (H00085477-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCIN Products

Research Areas for SCIN Antibody (H00085477-B01P)

Find related products by research area.

Blogs on SCIN

There are no specific blogs for SCIN, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCIN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCIN
Entrez
Uniprot