SCHIP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: IQCJ-SCHIP1 Antibody [NBP1-90887] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: IQCJ-SCHIP1 Antibody [NBP1-90887] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry: IQCJ-SCHIP1 Antibody [NBP1-90887] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCHIP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YSDRDTTEEESESLDDMDFLTRQKKLQAEAKMALAMAKPMAKMQVEVEKQNRKKSPVADLLPHMPHISECLMKRSLKPTDLRDMTIGQLQVIVNDLHSQIESLNEELVQLLLIRDELHTEQDAMLVDIEDLTRHAESQQKHMAEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCHIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SCHIP1 Recombinant Protein Antigen (NBP1-90887PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCHIP1 Antibody

  • FLJ39160
  • SCHIP-1schwannomin-interacting protein 1
  • schwannomin interacting protein 1

Background

pCMV-SCHIP1 Full length

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88826
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
594-ML/CF
Species: Mu
NBP2-00641
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-61027
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, Simple Western
MAB155
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
AF856
Species: Mu
Applications: WB, Flow, CyTOF-ready, Neut
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
AF2034
Species: Hu
Applications: WB, IHC
NBP1-85104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for SCHIP1 Antibody (NBP1-90887) (0)

There are no publications for SCHIP1 Antibody (NBP1-90887).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCHIP1 Antibody (NBP1-90887) (0)

There are no reviews for SCHIP1 Antibody (NBP1-90887). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SCHIP1 Antibody (NBP1-90887) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCHIP1 Products

Bioinformatics Tool for SCHIP1 Antibody (NBP1-90887)

Discover related pathways, diseases and genes to SCHIP1 Antibody (NBP1-90887). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCHIP1 Antibody (NBP1-90887)

Discover more about diseases related to SCHIP1 Antibody (NBP1-90887).
 

Pathways for SCHIP1 Antibody (NBP1-90887)

View related products by pathway.

Blogs on SCHIP1

There are no specific blogs for SCHIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCHIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCHIP1