SCFD1 Antibody

Images

 
Western Blot: SCFD1 Antibody [NBP1-88418] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: SCFD1 Antibody [NBP1-88418] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SCFD1 Antibody [NBP1-88418] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCFD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AALAASAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEMETVMDTIVDSLFCFFVTLGAVPIIRCSRGTAAEMVAVKLDKKLRENLRDARNSLFTGDTLGAGQFSFQRPL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCFD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SCFD1 Protein (NBP1-88418PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCFD1 Antibody

  • C14orf163
  • KIAA0917chromosome 14 open reading frame 163
  • sec1 family domain containing 1
  • sec1 family domain-containing protein 1
  • SLY1 homolog
  • SLY1
  • sly1p
  • STXBP1L2RA410
  • Syntaxin-binding protein 1-like 2
  • vesicle transport-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5687
Species: Hu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP1-83139
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-55113
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP2-92710
Species: Hu
Applications: IHC, IHC-P, WB
255-SC/CF
Species: Hu
Applications: BA
H00008615-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB100-98931
Species: Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-87035
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
H00053407-M13
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, S-ELISA, WB

Publications for SCFD1 Antibody (NBP1-88418) (0)

There are no publications for SCFD1 Antibody (NBP1-88418).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCFD1 Antibody (NBP1-88418) (0)

There are no reviews for SCFD1 Antibody (NBP1-88418). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SCFD1 Antibody (NBP1-88418) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCFD1 Products

Array NBP1-88418

Bioinformatics Tool for SCFD1 Antibody (NBP1-88418)

Discover related pathways, diseases and genes to SCFD1 Antibody (NBP1-88418). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCFD1 Antibody (NBP1-88418)

Discover more about diseases related to SCFD1 Antibody (NBP1-88418).
 

Pathways for SCFD1 Antibody (NBP1-88418)

View related products by pathway.

Blogs on SCFD1

There are no specific blogs for SCFD1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCFD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCFD1