SCF/c-kit Ligand Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

SCF/c-kit Ligand Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCF/c-kit Ligand.

  Source: E. coli

  Amino Acid Sequence: YWKKRQPSLTRAVENIQINEEDNEISMLQEK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KITLG
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57463.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SCF/c-kit Ligand Recombinant Protein Antigen

• c-kit Ligand
• DCUA
• DFNA69
• DKFZp686F2250
• familial progressive hyperpigmentation 2
• FPH2
• FPHH
• KIT ligand
• Kitl
• KITLG
• KL-1
• Mast cell growth factor
• MGF
• MGFSHEP7
• SCF
• SCFStem cell factor
• SFc-Kit ligand
• SHEP7
• SLF
• steel factor

Background

Mouse SCF (Stem cell factor, steel factor, Kit ligand, C-kit-ligand) is a hematopoietic growth factor that stimulates the proliferation of bone marrow stem cells. SCF induces the proliferation of mast cells and primitive lymphoid and myeloid hematopoietic bone marrow progenitor cells in culture. SCF acts synergistically with both GM-CSF and G-CSF, IL-7 and EPO. Mouse SCF is active on human cells as well as murine cells and can be used for long term bone marrow culture.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: KITLG