SCEL Antibody - BSA Free

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137] - Staining in human esophagus and liver tissues using NBP1-82137 antibody. Corresponding SCEL RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137] - Staining of human liver, skin, testis and tonsil using Anti-SCEL antibody NBP1-82137 (A) shows similar protein distribution across tissues to independent antibody NBP1-82138 (B).

Western Blot: SCEL Antibody [NBP1-82137] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137] - Staining of human esophagus shows strong membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137] - Staining of human skin shows moderate to strong cytoplasmic and membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137] - Staining of human tonsil shows strong cytoplasmic and membranous positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SCEL Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KVTPEVKRSNQGSKDLNNFIKVYPGTEKSTEGGQSLDSLIKVTPERNRTNQGNQDLENLIKVIPSANKSSEQGLDE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCEL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SCEL Protein (NBP1-82137PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SCEL Antibody - BSA Free

• FLJ21667
• MGC22531
• sciellin

Background

SCEL is encoded by this gene is a precursor to the cornified envelope of terminally differentiated keratinocytes. This protein localizes to the periphery of cells and may function in the assembly or regulation of proteins in the cornified envelope. Transcript variants encoding different isoforms exist. A transcript variant utilizing an alternative polyA signal has been described in the literature, but its full-length nature has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCEL