SCD5 Recombinant Protein Antigen

Images

 
There are currently no images for SCD5 Protein (NBP1-89274PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SCD5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCD5.

Source: E. coli

Amino Acid Sequence: NTQHIQKEGRALNQEAACEMLREWHQGHILKVTLPGLHILALLHTHCNHSEKCCLMLRALSVSLEVF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SCD5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89274.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SCD5 Recombinant Protein Antigen

  • ACOD4
  • ACOD4Acyl-CoA-desaturase 4
  • FADS4
  • FLJ21032
  • HSCD5
  • HSCD5Stearoyl-CoA 9-desaturase
  • SCD2
  • SCD4
  • SCD4EC 1.14.19.1
  • SCD5
  • stearoyl-CoA desaturase 4
  • stearoyl-CoA desaturase 5

Background

Stearoyl-CoA desaturase (SCD; EC 1.14.99.5) is an integral membrane protein of the endoplasmic reticulum that catalyzesthe formation of monounsaturated fatty acids from saturated fatty acids. SCD may be a key regulator of energymetabolism with a role in obesity and dislipidemia. Four SCD isoforms, Scd1 through Scd4, have been identified inmouse. In contrast, only 2 SCD isoforms, SCD1 (MIM 604031) and SCD5, have been identified in human. SCD1 shares about85% amino acid identity with all 4 mouse SCD isoforms, as well as with rat Scd1 and Scd2. In contrast, SCD5 shareslimited homology with the rodent SCDs and appears to be unique to primates (Wang et al., 2005 (PubMed15907797)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7550
Species: Hu
Applications: IP, KO, WB
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-59723
Species: Hu, Mu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56159
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB110-40760
Species: Fi, Hu, Mu, Po, Rt
Applications: Flow, IMC, ICC/IF, IHC,  IHC-P, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86960
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP3-26590
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, WB

Publications for SCD5 Protein (NBP1-89274PEP) (0)

There are no publications for SCD5 Protein (NBP1-89274PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCD5 Protein (NBP1-89274PEP) (0)

There are no reviews for SCD5 Protein (NBP1-89274PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SCD5 Protein (NBP1-89274PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCD5 Products

Research Areas for SCD5 Protein (NBP1-89274PEP)

Find related products by research area.

Blogs on SCD5

There are no specific blogs for SCD5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SCD5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SCD5