SC4MOL Antibody

Western Blot: SC4MOL Antibody [NBP1-59450] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml

Western Blot: SC4MOL Antibody [NBP1-59450] - Human Liver cell lysate, concentration 5.0ug/ml.

Product Discontinued

SC4MOL Antibody Summary

• Immunogen: Synthetic peptides corresponding to SC4MOL(sterol-C4-methyl oxidase-like) The peptide sequence was selected from the N terminal of SC4MOL (NP_006736). Peptide sequence MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MSMO1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against SC4MOL and was validated on Western blot.
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SC4MOL Antibody

• C-4 methyl sterol
• C-4 methylsterol oxidase
• EC 1.14.13.72
• ERG25DESP4Methylsterol monooxygenase
• MGC104344
• sterol-C4-methyl oxidase-like

Background

Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to function in cholesterol biosynthesis. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SC4MOL Antibody (NBP1-59450)(1)

Publication using NBP1-59450

• Lim J, Hao T, Shaw C et al. A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration. Cell 2006-05-19 [PMID: 16713569]

Bioinformatics

• Gene Symbol: MSMO1
• Entrez:
  • 6307(Human)
• Uniprot:
  • Q15800(Human)