SART3 Antibody - BSA Free

Immunohistochemistry: SART3 Antibody [NBP3-35220] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using SART3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: SART3 Antibody [NBP3-35220] - Immunohistochemistry analysis of paraffin-embedded Human lymph node using SART3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: SART3 Antibody [NBP3-35220] - Immunohistochemistry analysis of paraffin-embedded Mouse lung using SART3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: SART3 Antibody [NBP3-35220] - Western blot analysis of various lysates using SART3 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunohistochemistry: SART3 Antibody [NBP3-35220] - Immunohistochemistry analysis of paraffin-embedded Rat brain using SART3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SART3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SART3 Antibody - BSA Free (NBP3-35220) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 664-963 of human SART3 (NP_055521.1).
  
  Sequence:
  AGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLPQTYGARGKGRTQLSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLRK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SART3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 110 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SART3 Antibody - BSA Free

• DSAP1
• hSART-3
• KIAA0156squamous cell carcinoma antigen recognised by T cells 3
• P100
• p110
• p110(nrb)
• RP11-13G14
• SART-3
• squamous cell carcinoma antigen recognized by T cells 3
• squamous cell carcinoma antigen recognized by T-cells 3
• Tat-interacting protein of 110 kDa
• Tip110
• TIP110MGC138188

Background

SART3 is encoded by this gene is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This gene product is found to be an important cellular factor for HIV-1 gene expression and viral replication. It also associates transiently with U6 and U4/U6 snRNPs during the recycling phase of the spliceosome cycle. This encoded protein is thought to be involved in the regulation of mRNA splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SART3