SART1 Antibody

Images

 
Western Blot: SART1 Antibody [NBP1-89024] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: SART1 Antibody [NBP1-89024] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: SART1 Antibody [NBP1-89024] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Western Blot: SART1 Antibody [NBP1-89024] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SART1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SART1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SART1 Protein (NBP1-89024PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SART1 Antibody

  • Allergen Hom s 1
  • Ara1
  • HAF
  • HOMS1
  • hSART-1
  • hSnu66
  • hypoxia-associated factor
  • IgE Autoantigen
  • MGC2038
  • SART1
  • SART-1
  • SART1(259) protein
  • SART1(800) protein
  • SART1259
  • small nuclear ribonucleoprotein 110kDa (U4/U6.U5)
  • SNRNP110
  • SNU66 homolog
  • Snu66
  • squamous cell carcinoma antigen recognised by T cells
  • Squamous cell carcinoma antigen recognized by T cells 1
  • squamous cell carcinoma antigen recognized by T cells
  • U4/U6.U5 tri-snRNP-associated 110 kDa protein
  • U4/U6.U5 tri-snRNP-associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP1-87962
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45719
Species: Hu
Applications: WB, IHC
NB600-470
Species: Ye
Applications: WB, ELISA
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24651
Species: Hu, Mu, Eq, Pm
Applications: WB
NBP1-81653
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85358
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for SART1 Antibody (NBP1-89024) (0)

There are no publications for SART1 Antibody (NBP1-89024).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SART1 Antibody (NBP1-89024) (0)

There are no reviews for SART1 Antibody (NBP1-89024). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SART1 Antibody (NBP1-89024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SART1 Products

Bioinformatics Tool for SART1 Antibody (NBP1-89024)

Discover related pathways, diseases and genes to SART1 Antibody (NBP1-89024). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SART1 Antibody (NBP1-89024)

Discover more about diseases related to SART1 Antibody (NBP1-89024).
 

Pathways for SART1 Antibody (NBP1-89024)

View related products by pathway.

PTMs for SART1 Antibody (NBP1-89024)

Learn more about PTMs related to SART1 Antibody (NBP1-89024).

Blogs on SART1

There are no specific blogs for SART1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SART1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SART1
Entrez