SART1 Antibody - BSA Free

Western Blot: SART1 Antibody [NBP1-89023] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.

Immunocytochemistry/Immunofluorescence: SART1 Antibody [NBP1-89023] - Staining of human cell line A-431 shows localization to nuclear speckles & the Golgi apparatus.

Immunohistochemistry-Paraffin: SART1 Antibody [NBP1-89023] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Western Blot: SART1 Antibody [NBP1-89023] -Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)_br/_Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SART1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SART1 Antibody - BSA Free (NBP1-89023) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RRVKKIRKKEKEVVVRADDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVLEEDEAELELQKQLEKG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SART1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SART1 Protein (NBP1-89023PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SART1 Antibody - BSA Free

• Allergen Hom s 1
• Ara1
• HAF
• HOMS1
• hSART-1
• hSnu66
• hypoxia-associated factor
• IgE Autoantigen
• MGC2038
• SART1
• SART-1
• SART1(259) protein
• SART1(800) protein
• SART1259
• small nuclear ribonucleoprotein 110kDa (U4/U6.U5)
• SNRNP110
• SNU66 homolog
• Snu66
• squamous cell carcinoma antigen recognised by T cells
• Squamous cell carcinoma antigen recognized by T cells 1
• squamous cell carcinoma antigen recognized by T cells
• U4/U6.U5 tri-snRNP-associated 110 kDa protein
• U4/U6.U5 tri-snRNP-associated protein 1

Background

SART1, also known as hypoxia-associated factor (HAF), encodes two proteins, the SART1(800) protein expressed in the nucleus of the majority of proliferating cells, and the SART1(259) protein expressed in the cytosol of epithelial cancers. The SART1(259) protein is translated by the mechanism of -1 frameshifting during posttranscriptional regulation; its full-length sequence is not published yet. The two encoded proteins are thought to be involved in the regulation of proliferation. Both proteins have tumor-rejection antigens. The SART1(259) protein possesses tumor epitopes capable of inducing HLA-A2402-restricted cytotoxic T lymphocytes in cancer patients. This SART1(259) antigen may be useful in specific immunotherapy for cancer patients and may serve as a paradigmatic tool for the diagnosis and treatment of patients with atopy. The SART1(259) protein is found to be essential for the recruitment of the tri-snRNP to the pre-spliceosome in the spliceosome assembly pathway. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SART1