SAMD12 Antibody - BSA Free

Western Blot: SAMD12 Antibody [NBP1-81927] - Analysis in control (vector only transfected HEK293T lysate) and SAMD12 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: SAMD12 Antibody [NBP1-81927] - Staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SAMD12 Antibody [NBP1-81927] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SAMD12 Antibody [NBP1-81927] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SAMD12 Antibody [NBP1-81927] - Staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: SAMD12 Antibody [NBP1-81927] - Staining of human Colon shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SAMD12 Antibody [NBP1-81927] - Staining of human Pancreas shows moderate cytoplasmic positivity in islets of Langerhans.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SAMD12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SAMD12 Antibody - BSA Free (NBP1-81927) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LHCGLNPRGIDHPAHAEGIKLQIEGEGVESQSIKNKNFQKVPDQKGTPKRLQAEAETAKSATVKLSKPVALWTQQDVCKWLKKHCPNQYQIYSESF
• Predicted Species: Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SAMD12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:100-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SAMD12 Protein (NBP1-81927PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SAMD12 Antibody - BSA Free

• FLJ39458
• MGC148139
• MGC148140
• SAM domain-containing protein 12
• sterile alpha motif domain containing 12
• sterile alpha motif domain-containing protein 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SAMD12