Recombinant Human S1P1/EDG-1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human S1P1/EDG-1 Protein [H00001901-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human S1P1/EDG-1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-47 of Human S1P1/EDG-1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
S1PR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
30.91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human S1P1/EDG-1 GST (N-Term) Protein

  • CD363 antigen
  • CD363
  • CHEDG1
  • D1S3362
  • EDG1
  • EDG-1
  • EDG1edg-1
  • Endothelial differentiation G-protein coupled receptor 1
  • endothelial differentiation, sphingolipid G-protein-coupled receptor, 1
  • FLJ58121
  • S1P receptor 1
  • S1P receptor Edg-1
  • S1P1
  • S1P1ECGF1
  • S1PR1
  • sphingosine 1-phosphate receptor 1
  • sphingosine 1-phosphate receptor EDG1
  • Sphingosine 1-phosphate receptor Edg-1
  • sphingosine-1-phosphate receptor 1

Background

EDG1 - endothelial differentiation, sphingolipid G-protein-coupled receptor, 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-05160
Species: Hu
Applications: ICC/IF, IHC
NBP2-24762
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-26691
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-24712
Species: Hu, Mu, Rt, Ca, Pm, Xp
Applications: WB, IHC, IHC-P
H00008877-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP1-03363
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84903
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-24500
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00081502-P01
Species: Hu
Applications: WB
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS442
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
NLS2272
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
H00001901-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for S1P1/EDG-1 Partial Recombinant Protein (H00001901-Q01) (0)

There are no publications for S1P1/EDG-1 Partial Recombinant Protein (H00001901-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S1P1/EDG-1 Partial Recombinant Protein (H00001901-Q01) (0)

There are no reviews for S1P1/EDG-1 Partial Recombinant Protein (H00001901-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S1P1/EDG-1 Partial Recombinant Protein (H00001901-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional S1P1/EDG-1 Products

Bioinformatics Tool for S1P1/EDG-1 Partial Recombinant Protein (H00001901-Q01)

Discover related pathways, diseases and genes to S1P1/EDG-1 Partial Recombinant Protein (H00001901-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S1P1/EDG-1 Partial Recombinant Protein (H00001901-Q01)

Discover more about diseases related to S1P1/EDG-1 Partial Recombinant Protein (H00001901-Q01).
 

Pathways for S1P1/EDG-1 Partial Recombinant Protein (H00001901-Q01)

View related products by pathway.

PTMs for S1P1/EDG-1 Partial Recombinant Protein (H00001901-Q01)

Learn more about PTMs related to S1P1/EDG-1 Partial Recombinant Protein (H00001901-Q01).

Blogs on S1P1/EDG-1

There are no specific blogs for S1P1/EDG-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human S1P1/EDG-1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol S1PR1