S100A11 Antibody (2F4)

Images

 
Immunocytochemistry/ Immunofluorescence: S100A11 Antibody (2F4) [H00006282-M01] - Analysis of monoclonal antibody to S100A11 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: S100A11 Antibody (2F4) [H00006282-M01] - Analysis of monoclonal antibody to S100A11 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.
Sandwich ELISA: S100A11 Antibody (2F4) [H00006282-M01] - Detection limit for recombinant GST tagged S100A11 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

S100A11 Antibody (2F4) Summary

Immunogen
S100A11 (AAH14354, 1 a.a. - 105 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Specificity
S100 calcium binding protein A11 (calgizzarin)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
S100A11
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
Publications
Read Publications using
H00006282-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A11 Antibody (2F4)

  • Calgizzarin
  • Metastatic lymph node gene 70 protein
  • MLN 70
  • MLN70
  • protein S100-A11
  • Protein S100-C
  • S100 calcium binding protein A11
  • S100 calcium-binding protein A11 (calgizzarin)
  • S100 calcium-binding protein A11
  • S100A11
  • S100C
  • S100CS100 calcium binding protein A11 (calgizzarin)

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
AF4870
Species: Hu
Applications: WB, ICC
NBP2-46085
Species: Hu
Applications: WB, IHC
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56559
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
H00006282-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for S100A11 Antibody (H00006282-M01)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for S100A11 Antibody (H00006282-M01) (0)

There are no reviews for S100A11 Antibody (H00006282-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for S100A11 Antibody (H00006282-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100A11 Products

Bioinformatics Tool for S100A11 Antibody (H00006282-M01)

Discover related pathways, diseases and genes to S100A11 Antibody (H00006282-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A11 Antibody (H00006282-M01)

Discover more about diseases related to S100A11 Antibody (H00006282-M01).
 

Pathways for S100A11 Antibody (H00006282-M01)

View related products by pathway.

PTMs for S100A11 Antibody (H00006282-M01)

Learn more about PTMs related to S100A11 Antibody (H00006282-M01).
 

Research Areas for S100A11 Antibody (H00006282-M01)

Find related products by research area.

Blogs on S100A11

There are no specific blogs for S100A11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A11 Antibody (2F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A11
Entrez
OMIM
Uniprot