RUNX1T1/ETO Antibody - BSA Free

Immunohistochemistry: RUNX1T1/ETO Antibody [NBP2-49644] - Staining of human cerebral cortex shows moderate nucleolar positivity in neuronal cells, neuropil was moderately stained.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RUNX1T1/ETO Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPT
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RUNX1T1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RUNX1T1/ETO Recombinant Protein Antigen (NBP2-49644PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RUNX1T1/ETO Antibody - BSA Free

• AML1T1protein CBFA2T1
• CBFA2T1Cyclin-D-related protein
• CDRMGC2796
• core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclinD-related
• DKFZp564B213
• Eight twenty one protein
• ETOFLJ33145
• MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related
• Protein ETO
• Protein MTG8
• runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
• Zinc finger MYND domain-containing protein 2
• ZMYND2myeloid translocation gene on 8q22

Background

RUNX1T1 / ETO is encoded by this gene is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Several transcript variants encoding multiple isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RUNX1T1