RUNX1T1/ETO Antibody (5A12)

Images

 
Western Blot: RUNX1T1/ETO Antibody (5A12) [H00000862-M01] - Analysis of RUNX1T1 expression in transfected 293T cell line by RUNX1T1 monoclonal antibody (M01), clone 5A12.Lane 1: RUNX1T1 transfected lysate(67.566 ...read more
Immunocytochemistry/ Immunofluorescence: RUNX1T1/ETO Antibody (5A12) [H00000862-M01] - Analysis of monoclonal antibody to RUNX1T1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: RUNX1T1/ETO Antibody (5A12) [H00000862-M01] - Detection limit for recombinant GST tagged RUNX1T1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
5A12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RUNX1T1/ETO Antibody (5A12) Summary

Immunogen
RUNX1T1 (NP_004340 416 a.a. - 525 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICG
Specificity
RUNX1T1 - runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RUNX1T1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against transfected lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RUNX1T1/ETO Antibody (5A12)

  • AML1T1protein CBFA2T1
  • CBFA2T1Cyclin-D-related protein
  • CDRMGC2796
  • core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclinD-related
  • DKFZp564B213
  • Eight twenty one protein
  • ETOFLJ33145
  • MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related
  • Protein ETO
  • Protein MTG8
  • runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
  • Zinc finger MYND domain-containing protein 2
  • ZMYND2myeloid translocation gene on 8q22

Background

The protein encoded by this gene is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Several transcript variants encoding multiple isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB110-58345
Species: Hu, Mu, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-57758
Species: Hu
Applications: ICC/IF
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-56012
Species: Hu
Applications: ICC/IF
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-83435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
21370002
Species: Hu
Applications: WB, ChIP, ELISA
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00009139-M15
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00000862-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for RUNX1T1/ETO Antibody (H00000862-M01) (0)

There are no publications for RUNX1T1/ETO Antibody (H00000862-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUNX1T1/ETO Antibody (H00000862-M01) (0)

There are no reviews for RUNX1T1/ETO Antibody (H00000862-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX1T1/ETO Antibody (H00000862-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RUNX1T1/ETO Products

Bioinformatics Tool for RUNX1T1/ETO Antibody (H00000862-M01)

Discover related pathways, diseases and genes to RUNX1T1/ETO Antibody (H00000862-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX1T1/ETO Antibody (H00000862-M01)

Discover more about diseases related to RUNX1T1/ETO Antibody (H00000862-M01).
 

Pathways for RUNX1T1/ETO Antibody (H00000862-M01)

View related products by pathway.

PTMs for RUNX1T1/ETO Antibody (H00000862-M01)

Learn more about PTMs related to RUNX1T1/ETO Antibody (H00000862-M01).

Blogs on RUNX1T1/ETO

There are no specific blogs for RUNX1T1/ETO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUNX1T1/ETO Antibody (5A12) and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNX1T1
Entrez
OMIM
Uniprot