RTKN Antibody (2E5.)

Images

 
Western Blot: RTKN Antibody (2E5) [H00006242-M01] - RTKN monoclonal antibody (M01), clone 2E5 Analysis of RTKN expression in A-431.
Immunohistochemistry-Paraffin: RTKN Antibody (2E5) [H00006242-M01] - Analysis of monoclonal antibody to RTKN on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Sandwich ELISA: RTKN Antibody (2E5) [H00006242-M01] - Detection limit for recombinant GST tagged RTKN is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2E5.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RTKN Antibody (2E5.) Summary

Immunogen
RTKN (NP_149035 451 a.a. - 549 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VTDILTQREGARLETPPPWLAMFTDQPALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPPQRSPRTRGLCSKGQPRTWLQSP
Specificity
RTKN (2E5)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RTKN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. ICC/IF usage was reported in scientific literature.
Publications
Read Publications using
H00006242-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RTKN Antibody (2E5.)

  • B5
  • rhotekin
  • RTKN1

Background

This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-624
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-38016
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82881
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-13294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02852
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006242-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for RTKN Antibody (H00006242-M01)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for RTKN Antibody (H00006242-M01) (0)

There are no reviews for RTKN Antibody (H00006242-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RTKN Antibody (H00006242-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RTKN Products

Bioinformatics Tool for RTKN Antibody (H00006242-M01)

Discover related pathways, diseases and genes to RTKN Antibody (H00006242-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RTKN Antibody (H00006242-M01)

Discover more about diseases related to RTKN Antibody (H00006242-M01).
 

Pathways for RTKN Antibody (H00006242-M01)

View related products by pathway.

PTMs for RTKN Antibody (H00006242-M01)

Learn more about PTMs related to RTKN Antibody (H00006242-M01).

Blogs on RTKN

There are no specific blogs for RTKN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RTKN Antibody (2E5.) and receive a gift card or discount.

Bioinformatics

Gene Symbol RTKN
Entrez
OMIM
Uniprot