RSK3 Antibody

Images

 
Immunohistochemistry-Paraffin: RSK3 Antibody [NBP2-49125] - Staining of human vagina shows moderate cytoplasmic and nuclear membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RSK3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIK
Specificity
Specificity of human RSK3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS6KA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RSK3 Recombinant Protein Antigen (NBP2-49125PEP)

Reactivity Notes

Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RSK3 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • HU-2
  • MAP kinase-activated protein kinase 1c
  • MAPK-activated protein kinase 1c
  • MAPKAP kinase 1c
  • MAPKAPK1C
  • MAPKAPK-1c
  • p90-RSK 2
  • p90RSK2
  • p90-RSK3
  • ribosomal protein S6 kinase alpha 2
  • ribosomal protein S6 kinase alpha-2
  • ribosomal protein S6 kinase, 90kD, polypeptide 2
  • ribosomal protein S6 kinase, 90kDa, polypeptide 2
  • Ribosomal S6 kinase 3,90 kDa ribosomal protein S6 kinase 2
  • RPS6KA2
  • RSK
  • RSK3
  • RSK-3
  • RSK3pp90RSK3
  • S6K-alpha
  • S6K-alpha2
  • S6K-alpha-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-85085
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59722
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-89647
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49125
Species: Hu
Applications: IHC, IHC-P

Publications for RSK3 Antibody (NBP2-49125) (0)

There are no publications for RSK3 Antibody (NBP2-49125).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RSK3 Antibody (NBP2-49125) (0)

There are no reviews for RSK3 Antibody (NBP2-49125). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RSK3 Antibody (NBP2-49125) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RSK3 Antibody (NBP2-49125)

Discover related pathways, diseases and genes to RSK3 Antibody (NBP2-49125). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RSK3 Antibody (NBP2-49125)

Discover more about diseases related to RSK3 Antibody (NBP2-49125).
 

Pathways for RSK3 Antibody (NBP2-49125)

View related products by pathway.

PTMs for RSK3 Antibody (NBP2-49125)

Learn more about PTMs related to RSK3 Antibody (NBP2-49125).
 

Research Areas for RSK3 Antibody (NBP2-49125)

Find related products by research area.

Blogs on RSK3

There are no specific blogs for RSK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RSK3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KA2