![Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining of human skin.](http://images.novusbio.com/fullsize/RPTN-Antibody-Immunohistochemistry-Paraffin-NBP2-38159-img0009.jpg "Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining of human skin.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ETVETILNLLDQDRDGHIDFHEYLLLVFQLVQACYHKLDNKSHGGRTSQQERGQEGAQDCKFPGNTGRQHRQRHEEERQNSHHSQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RPTN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining of human cerebral cortex shows low expression as expected.](http://images.novusbio.com/fullsize/RPTN-Antibody-Immunohistochemistry-Paraffin-NBP2-38159-img0003.jpg "Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining of human cerebral cortex shows low expression as expected.")
![Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining of human hair shows moderate cytoplasmic positivity in a subset of cells in internal root sheath.](http://images.novusbio.com/fullsize/RPTN-Antibody-Immunohistochemistry-Paraffin-NBP2-38159-img0004.jpg "Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining of human hair shows moderate cytoplasmic positivity in a subset of cells in internal root sheath.")
![Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining of human tonsil shows high expression.](http://images.novusbio.com/fullsize/RPTN-Antibody-Immunohistochemistry-Paraffin-NBP2-38159-img0005.jpg "Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining of human tonsil shows high expression.")
![Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining in human tonsil and cerebral cortex tissues using anti-RPTN antibody. Corresponding RPTN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RPTN-Antibody-Immunohistochemistry-Paraffin-NBP2-38159-img0006.jpg "Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining in human tonsil and cerebral cortex tissues using anti-RPTN antibody. Corresponding RPTN RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining of human kidney, lymph node, skin and skin, hairy using Anti-RPTN antibody NBP2-38159 (A) shows similar protein distribution across tissues to independent antibody NBP1-93792 (B).](http://images.novusbio.com/fullsize/RPTN-Antibody-Immunohistochemistry-Paraffin-NBP2-38159-img0007.jpg "Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining of human kidney, lymph node, skin and skin, hairy using Anti-RPTN antibody NBP2-38159 (A) shows similar protein distribution across tissues to independent antibody NBP1-93792 (B).")
![Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining of human lymph node.](http://images.novusbio.com/fullsize/RPTN-Antibody-Immunohistochemistry-Paraffin-NBP2-38159-img0008.jpg "Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining of human kidney.](http://images.novusbio.com/fullsize/RPTN-Antibody-Immunohistochemistry-Paraffin-NBP2-38159-img0010.jpg "Immunohistochemistry-Paraffin: RPTN Antibody [NBP2-38159] - Staining of human kidney.")
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_10689.jpg)
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_6808.jpg)
![Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]](https://images.novusbio.com/images/af3844_human-mouse-desmin-affinity-purified-polyclonal-ab-41202410331920.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")