RPS25 Antibody - BSA Free

Western Blot: RPS25 Antibody [NBP1-80802] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: RPS25 Antibody [NBP1-80802] - Staining of human cell line A-431 shows localization to cytosol & endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in germinal center cells.

Western Blot: RPS25 Antibody [NBP1-80802] - Analysis in human cell line HELA.

Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802] - Staining of human heart muscle shows weak to moderate cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802] - Staining of human cervix, uterine shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: RPS25 Antibody [NBP1-80802] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RPS25 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RPS25 Antibody - BSA Free (NBP1-80802) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-RPS25 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPS25
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RPS25 Protein (NBP1-80802PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RPS25 Antibody - BSA Free

• ribosomal protein S25,40S ribosomal protein S25

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S25E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RPS25 Antibody (NBP1-80802)(3)

Publications using NBP1-80802

• Zhu X, Cruz VE, Zhang H et Al. Specific tRNAs promote mRNA decay by recruiting the CCR4-NOT complex to translating ribosomes Science 2024-10-09 [PMID: 39571015]
• Yishuang L, Jinyu K, Jia L et al Hepatocytic AP-1 and STAT3 contribute to chemotaxis in alphanaphthylisothiocyanate-induced cholestatic liver injury Toxicology Letters 2022-11-01 [PMID: 36460194]
• Abedini A, Landry DA, Macaulay AD et al. SWI/SNF chromatin remodeling subunit Smarca4/BRG1 is essential for female fertility Biology of reproduction 2022-11-28 [PMID: 36440965] (ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: RPS25
• Entrez:
  • 6230(Human)
• Uniprot:
  • P62851(Human)