RPS21 Antibody

Images

 
Western Blot: RPS21 Antibody [NBP1-54931] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPS21 Antibody Summary

Immunogen
Synthetic peptides corresponding to RPS21 (ribosomal protein S21) The peptide sequence was selected from the middle region of RPS21. Peptide sequence NVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RPS21 and was validated on Western blot.
Theoretical MW
9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPS21 Antibody

  • ribosomal protein S21,40S ribosomal protein S21,8.2 kDa differentiation factor

Background

The specific function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13263
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20223
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-58885
Species: Hu
Applications: WB, ICC/IF
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-22288
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-75649
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP1-80961
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
NBP1-80804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46191
Species: Hu, Mu
Applications: WB, IP
NBP1-92350
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00006202-Q01
Species: Hu
NB100-345
Species: Hu
Applications: WB, ChIP, IP

Publications for RPS21 Antibody (NBP1-54931) (0)

There are no publications for RPS21 Antibody (NBP1-54931).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS21 Antibody (NBP1-54931) (0)

There are no reviews for RPS21 Antibody (NBP1-54931). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPS21 Antibody (NBP1-54931) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RPS21 Antibody (NBP1-54931)

Discover related pathways, diseases and genes to RPS21 Antibody (NBP1-54931). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS21 Antibody (NBP1-54931)

Discover more about diseases related to RPS21 Antibody (NBP1-54931).
 

Pathways for RPS21 Antibody (NBP1-54931)

View related products by pathway.

Blogs on RPS21

There are no specific blogs for RPS21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS21
Uniprot