RPS19BP1 Antibody

Images

 
Western Blot: RPS19BP1 Antibody [NBP1-83617] - Analysis in human cell line PC-3.
Immunocytochemistry/ Immunofluorescence: RPS19BP1 Antibody [NBP1-83617] - Staining of human cell line A-431 shows localization to nucleus, nucleoli & cytosol.
Immunohistochemistry-Paraffin: RPS19BP1 Antibody [NBP1-83617] - Staining of human stomach shows moderate positivity in glandular cells.
Immunohistochemistry-Paraffin: RPS19BP1 Antibody [NBP1-83617] - Staining of human cerebral cortex shows moderate positivity in neuronal cells.
Immunohistochemistry-Paraffin: RPS19BP1 Antibody [NBP1-83617] - Staining of human lymph node shows moderate nuclear positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPS19BP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS19BP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPS19BP1 Protein (NBP1-83617PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPS19BP1 Antibody

  • 40S ribosomal protein S19-binding protein 1
  • AROS
  • dJ1104E15.4
  • FLJ21770
  • homolog of mouse S19 binding protein
  • MGC52010RPS19-binding protein 1
  • ribosomal protein S19 binding protein 1
  • S19BPactive regulator of SIRT1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
H00057167-M03
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-29941
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22294
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-16454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83617
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RPS19BP1 Antibody (NBP1-83617) (0)

There are no publications for RPS19BP1 Antibody (NBP1-83617).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS19BP1 Antibody (NBP1-83617) (0)

There are no reviews for RPS19BP1 Antibody (NBP1-83617). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPS19BP1 Antibody (NBP1-83617) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS19BP1 Products

Bioinformatics Tool for RPS19BP1 Antibody (NBP1-83617)

Discover related pathways, diseases and genes to RPS19BP1 Antibody (NBP1-83617). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS19BP1 Antibody (NBP1-83617)

Discover more about diseases related to RPS19BP1 Antibody (NBP1-83617).
 

Pathways for RPS19BP1 Antibody (NBP1-83617)

View related products by pathway.

PTMs for RPS19BP1 Antibody (NBP1-83617)

Learn more about PTMs related to RPS19BP1 Antibody (NBP1-83617).

Blogs on RPS19BP1

There are no specific blogs for RPS19BP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS19BP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS19BP1