Novus Biologicals products are now on bio-techne.com

RPS10 Antibody

Images

 
Western Blot: RPS10 Antibody [NBP1-98599] - Jurkat Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

RPS10 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
The immunogen for this antibody is RPS10 - C-terminal region. Peptide sequence PKGLEGERPARLTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP1-98599.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for RPS10 Antibody

  • DBA9,40S ribosomal protein S10
  • MGC88819
  • ribosomal protein S10

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S10E family of ribosomal proteins. It is located in the cytoplasm. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternate splicing results in multiple transcript variants that encode the same protein. Naturally occurring read-through transcription occurs between this locus and the neighboring locus NUDT3 (nudix (nucleoside diphosphate linked moiety X)-type motif 3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
H00006201-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006124-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-94073
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP1-87797
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NB100-2452
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-84847
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-27806
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP2-88192
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-46191
Species: Dr, Hu, Mu
Applications: IP, WB
NBP1-81290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83254
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-345
Species: Hu
Applications: ChIP, IP, KD, WB
H00006193-M02
Species: Hu, Mu, Pr, Rt
Applications: ELISA, ICC/IF, WB
NBP3-21449
Species: Hu
Applications: IHC-P
H00058516-B02P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00006192-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB

Publications for RPS10 Antibody (NBP1-98599)(2)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-98599 Applications Species
Riepe C Investigating the roles of ribosome-associated proteins in translational regulation of gene expression Thesis
Riepe C, Zelin E, Frankino PA et al. Double stranded DNA breaks and genome editing trigger loss of ribosomal protein RPS27A The FEBS journal 2021-12-16 [PMID: 34914197] (WB) WB

Reviews for RPS10 Antibody (NBP1-98599) (0)

There are no reviews for RPS10 Antibody (NBP1-98599). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPS10 Antibody (NBP1-98599) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS10 Products

Array NBP1-98599

Research Areas for RPS10 Antibody (NBP1-98599)

Find related products by research area.

Blogs on RPS10

There are no specific blogs for RPS10, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS10
Uniprot