RPL8 Antibody

Images

 
Western Blot: RPL8 Antibody [NBP2-48827] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RPL8 antibody. Remaining relative intensity is presented.
Immunohistochemistry-Paraffin: RPL8 Antibody [NBP2-48827] - Staining of human cerebellum, fallopian tube, pancreas and skin using Anti-RPL8 antibody NBP2-48827 (A) shows similar protein distribution across tissues to ...read more
Independent Antibodies: Western Blot: RPL8 Antibody [NBP2-48827] - Analysis using Anti-RPL8 antibody NBP2-48827 (A) shows similar pattern to independent antibody NBP2-47297 (B).
Western Blot: RPL8 Antibody [NBP2-48827] - Analysis using Anti-RPL8 antibody NBP2-48827 (A) shows similar pattern to independent antibody NBP2-47297 (B).
Immunohistochemistry: RPL8 Antibody [NBP2-48827] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: RPL8 Antibody [NBP2-48827] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: RPL8 Antibody [NBP2-48827] - Staining of human colon.
Immunohistochemistry-Paraffin: RPL8 Antibody [NBP2-48827] - Staining of human lymph node.
Immunohistochemistry-Paraffin: RPL8 Antibody [NBP2-48827] - Staining of human liver.
Immunohistochemistry-Paraffin: RPL8 Antibody [NBP2-48827] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: RPL8 Antibody [NBP2-48827] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: RPL8 Antibody [NBP2-48827] - Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: RPL8 Antibody [NBP2-48827] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

RPL8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETK
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RPL8 Recombinant Protein Antigen (NBP2-48827PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPL8 Antibody

  • ribosomal protein L8,60S ribosomal protein L8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2269
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
NBP3-05567
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-20216
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-13045
Species: Hu
Applications: ICC/IF, WB
MAB8164
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
NBP2-20214
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00029956-M01A
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-31413
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-82857
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00026156-B01P
Species: Hu
Applications: ICC/IF, WB
H00028299-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-20210
Species: Hu, I, Mu
Applications: IHC, IHC-P, WB
NBP1-84744
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-88446
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00058516-B02P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00006124-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-82853
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-48827
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD

Publications for RPL8 Antibody (NBP2-48827) (0)

There are no publications for RPL8 Antibody (NBP2-48827).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL8 Antibody (NBP2-48827) (0)

There are no reviews for RPL8 Antibody (NBP2-48827). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL8 Antibody (NBP2-48827) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL8 Products

Bioinformatics Tool for RPL8 Antibody (NBP2-48827)

Discover related pathways, diseases and genes to RPL8 Antibody (NBP2-48827). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL8 Antibody (NBP2-48827)

Discover more about diseases related to RPL8 Antibody (NBP2-48827).
 

Pathways for RPL8 Antibody (NBP2-48827)

View related products by pathway.

PTMs for RPL8 Antibody (NBP2-48827)

Learn more about PTMs related to RPL8 Antibody (NBP2-48827).

Blogs on RPL8

There are no specific blogs for RPL8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL8