RPL5 Recombinant Protein Antigen

Images

 
There are currently no images for RPL5 Recombinant Protein Antigen (NBP2-68710PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RPL5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPL5.

Source: E. coli

Amino Acid Sequence: RKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPL5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68710.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RPL5 Recombinant Protein Antigen

  • DBA6,60S ribosomal protein L5
  • MGC117339
  • ribosomal protein L5

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18P family of ribosomal proteins. It is located in the cytoplasm. The protein binds 5S rRNA to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rRNA to the nucleolus for assembly into ribosomes. The protein interacts specifically with the beta subunit of casein kinase II. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. This gene is co-transcribed with the small nucleolar RNA gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20215
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00058516-B02P
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-20214
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84537
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-20216
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF7514
Species: Mu
Applications: IHC, WB
NBP1-81328
Species: Hu
Applications: ICC/IF, WB
NBP1-83192
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80104
Species: Hu
Applications: WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-20210
Species: Hu, I, Mu, Ze
Applications: IHC-WhMt, IHC,  IHC-P, WB
NB100-2269
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
DBD00
Species: Hu
Applications: ELISA
NBP3-05567
Species: Hu, Mu
Applications: ICC/IF, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-68710PEP
Species: Hu
Applications: AC

Publications for RPL5 Recombinant Protein Antigen (NBP2-68710PEP) (0)

There are no publications for RPL5 Recombinant Protein Antigen (NBP2-68710PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL5 Recombinant Protein Antigen (NBP2-68710PEP) (0)

There are no reviews for RPL5 Recombinant Protein Antigen (NBP2-68710PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RPL5 Recombinant Protein Antigen (NBP2-68710PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPL5 Products

Research Areas for RPL5 Recombinant Protein Antigen (NBP2-68710PEP)

Find related products by research area.

Blogs on RPL5

There are no specific blogs for RPL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RPL5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL5