RPL32 Antibody (1B11)

Images

 
Immunocytochemistry/ Immunofluorescence: RPL32 Antibody (1B11) [H00006161-M04] - Analysis of monoclonal antibody to RPL32 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: RPL32 Antibody (1B11) [H00006161-M04] - Detection limit for recombinant GST tagged RPL32 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
1B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RPL32 Antibody (1B11) Summary

Immunogen
RPL32 (NP_000985, 33 a.a. - 132 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSE
Specificity
RPL32 - ribosomal protein L32 (1B11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPL32
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPL32 Antibody (1B11)

  • M
  • ribosomal protein L32,60S ribosomal protein L32

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding the same protein have been observed for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-82855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58847
Species: Hu
Applications: WB, IHC-P
NBP2-38971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32572
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-57476
Species: Hu
Applications: WB, ICC/IF, IHC
H00006143-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-33622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00006161-M04
Species: Hu
Applications: ELISA, ICC/IF

Publications for RPL32 Antibody (H00006161-M04) (0)

There are no publications for RPL32 Antibody (H00006161-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL32 Antibody (H00006161-M04) (0)

There are no reviews for RPL32 Antibody (H00006161-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPL32 Antibody (H00006161-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL32 Products

Bioinformatics Tool for RPL32 Antibody (H00006161-M04)

Discover related pathways, diseases and genes to RPL32 Antibody (H00006161-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL32 Antibody (H00006161-M04)

Discover more about diseases related to RPL32 Antibody (H00006161-M04).
 

Pathways for RPL32 Antibody (H00006161-M04)

View related products by pathway.

PTMs for RPL32 Antibody (H00006161-M04)

Learn more about PTMs related to RPL32 Antibody (H00006161-M04).

Blogs on RPL32

There are no specific blogs for RPL32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL32 Antibody (1B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL32
Entrez
Uniprot