RPL12 Antibody

Images

 
Western Blot: RPL12 Antibody [NBP1-82857] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: RPL12 Antibody [NBP1-82857] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells and decidua cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RPL12 Protein (NBP1-82857PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPL12 Antibody

  • ribosomal protein L12,60S ribosomal protein L12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84744
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-47297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82853
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57629
Species: Hu
Applications: ICC/IF
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-82857
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RPL12 Antibody (NBP1-82857) (0)

There are no publications for RPL12 Antibody (NBP1-82857).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL12 Antibody (NBP1-82857) (0)

There are no reviews for RPL12 Antibody (NBP1-82857). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL12 Antibody (NBP1-82857) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL12 Products

Bioinformatics Tool for RPL12 Antibody (NBP1-82857)

Discover related pathways, diseases and genes to RPL12 Antibody (NBP1-82857). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL12 Antibody (NBP1-82857)

Discover more about diseases related to RPL12 Antibody (NBP1-82857).
 

Pathways for RPL12 Antibody (NBP1-82857)

View related products by pathway.

PTMs for RPL12 Antibody (NBP1-82857)

Learn more about PTMs related to RPL12 Antibody (NBP1-82857).

Blogs on RPL12

There are no specific blogs for RPL12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL12