RPIA Antibody - BSA Free

Western Blot: RPIA Antibody [NBP1-56930] - 293T cells lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RPIA Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RPIA(ribose 5-phosphate isomerase A (ribose 5-phosphate epimerase)) The peptide sequence was selected from the N terminal of RPIA. Peptide sequence MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPIA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RPIA Antibody - BSA Free

• EC 5.3.1.6
• Phosphoriboisomerase
• ribose 5-phosphate epimerase
• ribose 5-phosphate isomerase A
• RPIribose-5-phosphate isomerase

Background

Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency. The exact function of RPIA remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPIA
• Uniprot:
  • P49247(Human)