RPC62 Recombinant Protein Antigen

Images

 
There are currently no images for RPC62 Protein (NBP1-87111PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RPC62 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLR3C.

Source: E. coli

Amino Acid Sequence: VINLHKALASLATATLESVVQERFGSRCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRTFYLYTVNILSAARM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POLR3C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87111.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RPC62 Recombinant Protein Antigen

  • DNA-directed III 62 kDa polypeptide
  • DNA-directed RNA polymerase III subunit C
  • DNA-directed RNA polymerase III subunit RPC3
  • polymerase (RNA) III (DNA directed) polypeptide C (62kD)
  • RNA polymerase III 62 kDa subunit
  • RNA polymerase III subunit C3
  • RPC62RPC3

Background

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. May direct with other members of the subcomplex RNA Pol III binding to the TFIIIB-DNA complex via the interactions between TFIIIB and POLR3F. May be involved either in the recruitment and stabilization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53092
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP3-48813
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00009533-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-84628
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP1-82655
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-76929
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-80817
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84621
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-00482
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-47329
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-80816
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-93617
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NB200-598
Species: Hu, Mu, Pm(-), Ye
Applications: ChIP, CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IP, WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87113
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00001678-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00080279-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-87111PEP
Species: Hu
Applications: AC

Publications for RPC62 Protein (NBP1-87111PEP) (0)

There are no publications for RPC62 Protein (NBP1-87111PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPC62 Protein (NBP1-87111PEP) (0)

There are no reviews for RPC62 Protein (NBP1-87111PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RPC62 Protein (NBP1-87111PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPC62 Products

Blogs on RPC62

There are no specific blogs for RPC62, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RPC62 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR3C