RPB9 Antibody

Images

 
Western Blot: RPB9 Antibody [NBP2-88179] - WB Suggested Anti-POLR2I Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Placenta

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPB9 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RPB9. Peptide sequence: EPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
POLR2I
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPB9 Antibody

  • DNA-directed RNA polymerase II 14.5 kDa polypeptide
  • DNA-directed RNA polymerase II subunit I
  • DNA-directed RNA polymerase II subunit RPB9
  • hRPB14.5
  • polymerase (RNA) II (DNA directed) polypeptide I (14.5kD)
  • polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa
  • RNA polymerase II 14.5 kDa subunit
  • RNA polymerase II subunit B9
  • RPB14.5
  • RPB9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-598
Species: Hu, Mu, Pm(-), Ye
Applications: ChIP, CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IP, WB
H00006919-B02P
Species: Hu
Applications: ICC/IF, WB
NBP1-93707
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006920-M08
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-00482
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-53092
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP3-03839
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-32622
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80817
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81714
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32716
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-80816
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-17971
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP3-17973
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93617
Species: Hu, Mu
Applications: ICC/IF, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP2-75398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1152
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-88179
Species: Hu
Applications: WB

Publications for RPB9 Antibody (NBP2-88179) (0)

There are no publications for RPB9 Antibody (NBP2-88179).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPB9 Antibody (NBP2-88179) (0)

There are no reviews for RPB9 Antibody (NBP2-88179). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPB9 Antibody (NBP2-88179) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPB9 Products

Array NBP2-88179

Bioinformatics Tool for RPB9 Antibody (NBP2-88179)

Discover related pathways, diseases and genes to RPB9 Antibody (NBP2-88179). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for RPB9 Antibody (NBP2-88179)

Find related products by research area.

Blogs on RPB9

There are no specific blogs for RPB9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPB9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR2I