RPB2 Antibody - BSA Free

Western Blot: RPB2 Antibody [NBP2-88175] - WB Suggested Anti-POLR2B Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Muscle

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RPB2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RPB2 Antibody - BSA Free (NBP2-88175) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPB2. Peptide sequence: FFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POLR2B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RPB2 Antibody - BSA Free

• DNA-directed RNA polymerase II subunit RPB2
• EC 2.7.7
• EC 2.7.7.6
• hRPB140
• hsRPB2
• POL2RB
• polymerase (RNA) II (DNA directed) polypeptide B (140kD)
• polymerase (RNA) II (DNA directed) polypeptide B, 140kDa
• RNA polymerase II subunit 2
• RNA polymerase II subunit B2
• RNA polymerase II subunit2, RNA polymerase II second largest subunit

Background

It is suggested that Rpb2, a 140 kDa protein, plays a role is enhancing transcription from prostate specific antigen genes. These genes may be linked to prostate cancer progression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POLR2B