RPA14 Antibody (1F4)

Images

 
Western Blot: RPA14 Antibody (1F4) [H00006119-M01] - RPA3 monoclonal antibody (M01), clone 1F4 Analysis of RPA3 expression in HL-60.
Immunohistochemistry-Paraffin: RPA14 Antibody (1F4) [H00006119-M01] - Analysis of monoclonal antibody to RPA3 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.
Western Blot: RPA14 Antibody (1F4) [H00006119-M01] - Analysis of RPA3 over-expressed 293 cell line, cotransfected with RPA3 Validated Chimera RNAi ( Cat # H00006119-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: RPA14 Antibody (1F4) [H00006119-M01] - Analysis of RPA3 expression in transfected 293T cell line by RPA3 monoclonal antibody (M01), clone 1F4.Lane 1: RPA3 transfected lysate(13.6 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, RNAi
Clone
1F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RPA14 Antibody (1F4) Summary

Immunogen
RPA3 (AAH05264, 12 a.a. - 121 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. INAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD
Localization
Nuclear
Specificity
RPA3 - replication protein A3, 14kDa
Isotype
IgG1 Lambda
Clonality
Monoclonal
Host
Mouse
Gene
RPA3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPA14 Antibody (1F4)

  • REPA3Replication factor A protein 3
  • replication protein A 14 kDa subunit
  • replication protein A3 (14kD)
  • replication protein A3, 14kDa
  • RF-A protein 3
  • RP-A p14
  • RPA14

Background

Replication protein A (RPA) is a single-stranded DNA binding protein. Human RPA is a heterotrimeric protein containing subunits of 70, 32 and 14 kDa. This protein complex is highly conserved in eukaryotes and is essential in DNA replication, homologous recombination and nucleotide excision repair. RPA has been shown to be a target for DNA-dependent protein kinase (DNA-PK) ataxia telangiectasia-mutated gene (ATM) and a cyclin dependent protein kinase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2204
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PLA
NBP1-23017
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-32016
Species: Hu
Applications: IHC, IHC-P
H00084172-M10
Species: Hu
Applications: WB, ELISA, ICC/IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
H00029935-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-47329
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00006119-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi

Publications for RPA14 Antibody (H00006119-M01) (0)

There are no publications for RPA14 Antibody (H00006119-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPA14 Antibody (H00006119-M01) (0)

There are no reviews for RPA14 Antibody (H00006119-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPA14 Antibody (H00006119-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPA14 Products

Bioinformatics Tool for RPA14 Antibody (H00006119-M01)

Discover related pathways, diseases and genes to RPA14 Antibody (H00006119-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPA14 Antibody (H00006119-M01)

Discover more about diseases related to RPA14 Antibody (H00006119-M01).
 

Pathways for RPA14 Antibody (H00006119-M01)

View related products by pathway.

PTMs for RPA14 Antibody (H00006119-M01)

Learn more about PTMs related to RPA14 Antibody (H00006119-M01).
 

Research Areas for RPA14 Antibody (H00006119-M01)

Find related products by research area.

Blogs on RPA14

There are no specific blogs for RPA14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RPA14 RNAi
H00006119-R01V-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPA14 Antibody (1F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol RPA3
Entrez
OMIM
Uniprot