RNF19B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RNF19B Antibody [NBP2-14688] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Immunohistochemistry-Paraffin: RNF19B Antibody [NBP2-14688] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RNF19B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: AQPESIRSDLESSDAQSDDVPDITSDECGSPRSHTAACPSTPRAQGAPSPSAHMNLSALAEGQTVLKPEGGEA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF19B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RNF19B Protein (NBP2-14688PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RNF19B Antibody - BSA Free

• IBRDC3
• NKLAM
• RNF19B ring finger protein 19B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for RNF19B Antibody (NBP2-14688). (Showing 1 - 1 of 1 FAQ).

1. I'm interested to know if your RNF19B antibody works well for western blotting applications? I am currently working on a project characterizing this protein as an interferon induced gene product, but other antibodies I have tried have not shown an interferon-induced band at the proper molecular weight.
   • Our product NBP2-14688 (RNF19B) has not yet been validated in western blot. I therefore cannot tell you with certainty if the antibody will recognize the interferon-induced band. The datasheet includes the immunogen sequence this antibody was made to, and if you would like to try it in western blot, you can qualify for our Innovator's Reward program. In exchange for your experimental review of an untested application or species, we would issue you a credit for the purchase price of the antibody. Contact us at innovators@novusbio.com for more information.

Bioinformatics

• Gene Symbol: RNF19B